Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceroid-lipofuscinosis neuronal protein 5 (CLN5)

Product Specifications

Product Name Alternative

(Protein CLN5)

Abbreviation

Recombinant Human CLN5 protein

Gene Name

CLN5

UniProt

O75503

Expression Region

47-358aa

Organism

Homo sapiens (Human)

Target Sequence

IPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a role in influencing the retrograde trafficking of lysosomal sorting receptors SORT1 and IGF2R from the endosomes to the trans-Golgi network by controlling the recruitment of retromer complex to the endosomal membrane. Regulates the localization and activation of RAB7A which is required to recruit the retromer complex to the endosomal membrane.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.1 kDa

References & Citations

"The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting." Mamo A., Jules F., Dumaresq-Doiron K., Costantino S., Lefrancois S. Mol. Cell. Biol. 32:1855-1866 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cog1 (BC063056) Mouse Tagged ORF Clone
MG211374 10 µg

Cog1 (BC063056) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NIS (Sodium Iodide Symporter) (MaxLight 650)
MBS6246559-01 0.1 mL

NIS (Sodium Iodide Symporter) (MaxLight 650)

Sign In for Pricing
View Details
NIS (Sodium Iodide Symporter) (MaxLight 650)
MBS6246559-02 5x 0.1 mL

NIS (Sodium Iodide Symporter) (MaxLight 650)

Sign In for Pricing
View Details
Mouse ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit
MBS1600959-01 48 Well

Mouse ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit

Sign In for Pricing
View Details
Mouse ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit
MBS1600959-02 96 Well

Mouse ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit

Sign In for Pricing
View Details
Mouse ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit
MBS1600959-03 5x 96 Well

Mouse ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit

Sign In for Pricing
View Details