What is the catalog number for EGF, Human?

The catalog number for EGF, Human is HY-P7109.

What sizes are available for EGF, Human?

EGF, Human is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg, 250 µg, 500 µg, 1 mg.

How many pack sizes does EGF, Human come in?

EGF, Human is available in 7 different pack sizes.

Is EGF, Human in stock?

EGF, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures EGF, Human?

EGF, Human is manufactured by QuantiMol.

What is the estimated delivery time for EGF, Human?

Estimated delivery time for EGF, Human is approximately 15 business day(s), depending on your location.

EGF, Human

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

EGF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

JAK/STAT Signaling;Protein Tyrosine Kinase/RTK

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-human.html

Purity

98.00

Smiles

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Formula

1950 (Gene_ID) P01133-1 (N971-R1023) (Accession)

Molecular Weight

Approximately 5-11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Wong WR, et al. Applications, and efficient large-scale production, of recombinant human epidermal growth factor. Biotechnol Genet Eng Rev. 2001;18:51-71.|[2]Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102 (2) :89-98.|[3]Pouranvari S, et al., Cloning, Expression, and Cost Effective Purification of Authentic Human Epidermal Growth Factor With High Activity. Iran Red Crescent Med J. 2016 Mar 20;18 (3) :e24966.