EGF, Human
EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
EGF Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Related Pathways
JAK/STAT Signaling;Protein Tyrosine Kinase/RTK
Assay Protocol
https://www.medchemexpress.com/cytokines/egf-protein-human.html
Purity
98.00
Smiles
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Molecular Formula
1950 (Gene_ID) P01133-1 (N971-R1023) (Accession)
Molecular Weight
Approximately 5-11 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog