Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant HumanKelch-like ECH-associated protein 1 (KEAP1), partial

Product Specifications

Product Name Alternative

Cytosolic inhibitor of Nrf2; INrf2; Kelch-like protein 19

Abbreviation

Recombinant Human KEAP1 protein, partial

Gene Name

KEAP1

UniProt

Q14145

Expression Region

322-624aa

Organism

Homo sapiens (Human)

Target Sequence

PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that regulates the response to oxidative stress by targeting NFE2L2/NRF2 for ubiquitination. KEAP1 acts as a key sensor of oxidative and electrophilic stress: in normal conditions, the BCR (KEAP1) complex mediates ubiquitination and degradation of NFE2L2/NRF2, a transcription factor regulating expression of many cytoprotective genes. In response to oxidative stress, different electrophile metabolites trigger non-enzymatic covalent modifications of highly reactive cysteine residues in KEAP1, leading to inactivate the ubiquitin ligase activity of the BCR (KEAP1) complex, promoting NFE2L2/NRF2 nuclear accumulation and expression of phase II detoxifying enzymes. In response to selective autophagy, KEAP1 is sequestered in inclusion bodies following its interaction with SQSTM1/p62, leading to inactivation of the BCR (KEAP1) complex and activation of NFE2L2/NRF2. The BCR (KEAP1) complex also mediates ubiquitination of SQSTM1/p62, increasing SQSTM1/p62 sequestering activity and degradation. The BCR (KEAP1) complex also targets BPTF and PGAM5 for ubiquitination and degradation by the proteasome.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-FGFR1/CD331 Antibody
HY-P990415 1 Each

Anti-FGFR1/CD331 Antibody

Ask
View Details
F(ab')2 Cat IgG (H&L) Antibody Rhodamine Conjugated
TA398107 500 µL

F(ab')2 Cat IgG (H&L) Antibody Rhodamine Conjugated

Ask
View Details
Human Brain FibrOut™11: Fibroblast Inhibitory System (for 500 mL medium)
7-15280 1 Kit

Human Brain FibrOut™11: Fibroblast Inhibitory System (for 500 mL medium)

Ask
View Details
AOX1 (Aldehyde Oxidase, Aldehyde Oxidase 1, Azaheterocycle hydroxylase, AOX1, AO, AOX-1) discontinued
220760-01 50 µL

AOX1 (Aldehyde Oxidase, Aldehyde Oxidase 1, Azaheterocycle hydroxylase, AOX1, AO, AOX-1) discontinued

Ask
View Details
AOX1 (Aldehyde Oxidase, Aldehyde Oxidase 1, Azaheterocycle hydroxylase, AOX1, AO, AOX-1) discontinued
220760-02 100 µL

AOX1 (Aldehyde Oxidase, Aldehyde Oxidase 1, Azaheterocycle hydroxylase, AOX1, AO, AOX-1) discontinued

Ask
View Details
2- (2- (Pyridin-2-yl) -1H-imidazol-4-yl) ethan-1-amine dihydrochloride
MF-0055409-01 10 mg

2- (2- (Pyridin-2-yl) -1H-imidazol-4-yl) ethan-1-amine dihydrochloride

Ask
View Details