Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant JC polyomavirus Major capsid protein VP1

Product Specifications

Product Name Alternative

Major structural protein VP1

Abbreviation

Recombinant JC polyomavirus Major capsid protein VP1 protein

UniProt

P03089

Expression Region

1-354aa

Organism

JC polyomavirus (JCPyV) (JCV)

Target Sequence

MAPTKRKGERKDPVQVPKLLIRGGVEVLEVKTGVDSITEVECFLTPEMGDPDEHLRGFSKSISISDTFESDSPNRDMLPCYSVARIPLPNLNEDLTCGNILMWEAVTLKTEVIGVTSLMNVHSNGQATHDNGAGKPVQGTSFHFFSVGGEALELQGVLFNYRTKYPDGTIFPKNATVQSQVMNTEHKAYLDKNKAYPVECWVPDPTRNENTRYFGTLTGGENVPPVLHITNTATTVLLDEFGVGPLCKGDNLYLSAVDVCGMFTNRSGSQQWRGLSRYFKVQLRKRRVKNPYPISFLLTDLINRRTPRVDGQPMYGMDAQVEEVRVFEGTEELPGDPDMMRYVDKYGQLQTKML

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Forms an icosahedral capsid with a T=7 symmetry and a 40 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with VP2 or VP3 proteins. Interacts with a N-linked glycoprotein containing terminal alpha (2-6) -linked sialic acids on the cell surface to provide virion attachment to target cell. The serotonergic receptor 5HT2AR also acts as a cellular receptor for JCV on human glial cells. Once attached, the virions enter predominantly by a ligand-inducible clathrin-dependent pathway and traffic to the ER. Inside the endoplasmic reticulum, the protein folding machinery isomerizes VP1 interpentamer disulfide bonds, thereby triggering initial uncoating. Next, the virion uses the endoplasmic reticulum-associated degradation machinery to probably translocate in the cytosol before reaching the nucleus. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2/Vp3 nuclear localization signal. In late phase of infection, neo-synthesized VP1 encapsulates replicated genomic DNA at nuclear domains called promyelocytic leukemia (PML) bodies, and participates in rearranging nucleosomes around the viral DNA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

T807 500mg
A20538-500 500 mg

T807 500mg

Ask
View Details
Ptov1 siRNA Oligos set (Rat)
38126176 3x 5 nmol

Ptov1 siRNA Oligos set (Rat)

Ask
View Details
Chicken gamma-Glutamyl Systeine Synthetase (gamma-ECS/GCLC) ELISA kit
YLA0209CH-01 48 Tests

Chicken gamma-Glutamyl Systeine Synthetase (gamma-ECS/GCLC) ELISA kit

Ask
View Details
Chicken gamma-Glutamyl Systeine Synthetase (gamma-ECS/GCLC) ELISA kit
YLA0209CH-02 96 Tests

Chicken gamma-Glutamyl Systeine Synthetase (gamma-ECS/GCLC) ELISA kit

Ask
View Details
pBARGPE1-3×FLAG-EGFP-Hyg Plasmid
PVT49175 2 µg

pBARGPE1-3×FLAG-EGFP-Hyg Plasmid

Ask
View Details
Recombinant Salmonella dublin L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
MBS1263436-01 0.02 mg (E-Coli)

Recombinant Salmonella dublin L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)

Ask
View Details