What is the catalog number for SCF, Human?

The catalog number for SCF, Human is HY-P70781.

What sizes are available for SCF, Human?

SCF, Human is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does SCF, Human come in?

SCF, Human is available in 4 different pack sizes.

Is SCF, Human in stock?

SCF, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures SCF, Human?

SCF, Human is manufactured by QuantiMol.

What is the estimated delivery time for SCF, Human?

Estimated delivery time for SCF, Human is approximately 15 business day(s), depending on your location.

SCF, Human

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human is the recombinant human-derived SCF protein, expressed in E. coli.

Product Specifications

Product Name Alternative

SCF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-human.html

Purity

98.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Dehbashi M, Kamali E, Vallian S. Comparative genomics of human stem cell factor (SCF) . Mol Biol Res Commun. 2017;6 (1) :1-11.|[2]Lennartsson J, Rönnstrand L. Stem cell factor receptor/c-Kit: from basic science to clinical implications. Physiol Rev. 2012;92 (4) :1619-1649.|[3]Irani A M, et al. Recombinant human stem cell factor stimulates differentiation of mast cells from dispersed human fetal liver cells[J]. 1992.|[4]Akuta T, et al., Expression of bioactive soluble human stem cell factor (SCF) from recombinant Escherichia coli by coproduction of thioredoxin and efficient purification using arginine in affinity chromatography. Protein Expr Purif. 2015 Jan;105:1-7.