Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 2/TGFB2, Human (HEK293)

Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2) . TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development[1][2]. TGF beta 2/TGFB2 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A303-S414) .

Product Specifications

Product Name Alternative

TGF beta 2/TGFB2 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgfb2-protein-human.html

Purity

98.0

Smiles

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Molecular Formula

7042 (Gene_ID) P61812-1 (A303-S414) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hirokazu Takahashi, et al. TGF-β2 is an exercise-induced adipokine that regulates glucose and fatty acid metabolism. Nat Metab. 2019 Feb;1 (2) :291-303.|[2]Zunqiang Xiao, et al. TGFβ2 is a prognostic-related biomarker and correlated with immune infiltrates in gastric cancer. J Cell Mol Med. 2020 Jul;24 (13) :7151-7162.|[3]Anne Dropmann, et al. TGF-β2 silencing to target biliary-derived liver diseases. Gut. 2020 Sep;69 (9) :1677-1690.|[4]Gulab S Zode, et al. Transforming growth factor-β2 increases extracellular matrix proteins in optic nerve head cells via activation of the Smad signaling pathway. Mol Vis. 2011;17:1745-58.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-100 1x 100 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-500 1x 500 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF405S conjugate, 0.1mg/mL
BNC041556-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details