Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF19 (B-11) FITC
sc-166026 FITC 200 µg/mL

ZNF19 (B-11) FITC

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Human Clusterin / CLUS (23-449) Membrane Protein, PaRoom Temperatureial, -His tag
MP1337F Each

Magic™ Antibody Discovery - Human Clusterin / CLUS (23-449) Membrane Protein, PaRoom Temperatureial, -His tag

Sign In for Pricing
View Details
Recombinant Human Hepatoma-Derived Growth Factor/HDGF (C-6His)
32-8156-50 50 µg

Recombinant Human Hepatoma-Derived Growth Factor/HDGF (C-6His)

Sign In for Pricing
View Details
Rabbit Polyclonal MICAL1 Antibody
NBP2-17287 0.1 mL

Rabbit Polyclonal MICAL1 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Lars shRNA (UAS) - Lentiviral mouse Lars shRNA (UAS, RFP) plasmid
GTR15284233 1 Vial

Lentiviral mouse Lars shRNA (UAS) - Lentiviral mouse Lars shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
UBL3 Antibody, FITC conjugated
A37945-100UG 100 µg

UBL3 Antibody, FITC conjugated

Sign In for Pricing
View Details