Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAN-190 hydrobromide
0553/250 250 mg

NAN-190 hydrobromide

Sign In for Pricing
View Details
Anti-PLAGL1 Antibody
A1658-100 100 µL

Anti-PLAGL1 Antibody

Sign In for Pricing
View Details
Human Agrin (AGRN) ELISA Kit
KTE60966-01 48 Tests

Human Agrin (AGRN) ELISA Kit

Sign In for Pricing
View Details
Human Agrin (AGRN) ELISA Kit
KTE60966-02 96 Tests

Human Agrin (AGRN) ELISA Kit

Sign In for Pricing
View Details
Human Agrin (AGRN) ELISA Kit
KTE60966-03 5x 96 Tests

Human Agrin (AGRN) ELISA Kit

Sign In for Pricing
View Details
Human Agrin (AGRN) ELISA Kit
KTE60966-04 50x 96 Tests

Human Agrin (AGRN) ELISA Kit

Sign In for Pricing
View Details