Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif2c2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6903108 1.0 µg DNA

Eif2c2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
SLC25A15P CRISPRa sgRNA lentivector (set of three targets)(Human)
67527121 3x 1.0µg DNA

SLC25A15P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Polymyxin B Separopore® 4B-CL (Endotoxin Affisorbent™ )
20181092-3 25 mL

Polymyxin B Separopore® 4B-CL (Endotoxin Affisorbent™ )

Sign In for Pricing
View Details
TMEM87A (NM_001110503) Human Over-expression Lysate
LH02572V 100 µg

TMEM87A (NM_001110503) Human Over-expression Lysate

Sign In for Pricing
View Details
Cystatin S (CST4) Mouse Monoclonal Capture Antibody [Clone ID: OTI1B1]
TA600264 100 µg

Cystatin S (CST4) Mouse Monoclonal Capture Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details
CDC25A Blocking Peptide
CBP3834-01 1 mg

CDC25A Blocking Peptide

Sign In for Pricing
View Details