Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBED4 Protein Lysate (Human) with C-Ha Tag
50679031 100 µg

ZBED4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Duck Sulfotransferase 1C4 (SULT1C4) ELISA Kit
MBS9939273 Inquire

Duck Sulfotransferase 1C4 (SULT1C4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CD59 Protein, N-GST
HB615012-01 50 µg

Recombinant Human CD59 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CD59 Protein, N-GST
HB615012-02 100 µg

Recombinant Human CD59 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CD59 Protein, N-GST
HB615012-03 1 mg

Recombinant Human CD59 Protein, N-GST

Sign In for Pricing
View Details
Lentiviral mouse Nphp3 shRNA (UAS) - Lentiviral mouse Nphp3 shRNA (UAS) (100)
GTR15228738 1 Vial

Lentiviral mouse Nphp3 shRNA (UAS) - Lentiviral mouse Nphp3 shRNA (UAS) (100)

Sign In for Pricing
View Details