Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCB 43 [CAS:70362-46-8] 500ug/ml in Iso-octane
PCB043K5ZT1 1 mL

PCB 43 [CAS:70362-46-8] 500ug/ml in Iso-octane

Sign In for Pricing
View Details
Lentiviral human ANXA8L1 shRNA (UAS) - Lentiviral human ANXA8L1 shRNA (UAS, iRFP) (100)
GTR15339822 1 Vial

Lentiviral human ANXA8L1 shRNA (UAS) - Lentiviral human ANXA8L1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CD32 (FCGR2A, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, IgG Fc Receptor II-a, FCGR2A, FCG2, FCGR2A1, IGFR2) (MaxLight 750)
MBS6232011-01 0.1 mL

CD32 (FCGR2A, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, IgG Fc Receptor II-a, FCGR2A, FCG2, FCGR2A1, IGFR2) (MaxLight 750)

Sign In for Pricing
View Details
CD32 (FCGR2A, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, IgG Fc Receptor II-a, FCGR2A, FCG2, FCGR2A1, IGFR2) (MaxLight 750)
MBS6232011-02 5x 0.1 mL

CD32 (FCGR2A, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, IgG Fc Receptor II-a, FCGR2A, FCG2, FCGR2A1, IGFR2) (MaxLight 750)

Sign In for Pricing
View Details
RPL7AP31 3'UTR GFP Stable Cell Line
TU070524 1.0 mL

RPL7AP31 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tmem25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
47032116 3x 1.0 µg

Tmem25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details