Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Integrin alpha 4/CD49d Antibody (21.6) [Alexa Fluor 594]
NBP2-81092AF594 0.1 mL

Rabbit Monoclonal Integrin alpha 4/CD49d Antibody (21.6) [Alexa Fluor 594]

Sign In for Pricing
View Details
Rabbit Polyclonal EFCAB6 Antibody
NBP1-84237-25ul 25 µL

Rabbit Polyclonal EFCAB6 Antibody

Sign In for Pricing
View Details
Urea Phosphate Extrapure
02811 00500 500 g

Urea Phosphate Extrapure

Sign In for Pricing
View Details
Zfyve27 (NM_177319) Mouse Untagged Clone
MC214423 10 µg

Zfyve27 (NM_177319) Mouse Untagged Clone

Sign In for Pricing
View Details
Rho Guanine Nucleotide Exchange Factor 9 (ARHGEF9) Antibody
abx031647-01 80 µL

Rho Guanine Nucleotide Exchange Factor 9 (ARHGEF9) Antibody

Sign In for Pricing
View Details
Rho Guanine Nucleotide Exchange Factor 9 (ARHGEF9) Antibody
abx031647-02 400 µL

Rho Guanine Nucleotide Exchange Factor 9 (ARHGEF9) Antibody

Sign In for Pricing
View Details