Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filter Paper Discs S - 55mm
SLS2109 100 / PCK

Filter Paper Discs S - 55mm

Sign In for Pricing
View Details
SLC39A5 siRNA (Human)
CRJ6898-01 15 nmol

SLC39A5 siRNA (Human)

Sign In for Pricing
View Details
SLC39A5 siRNA (Human)
CRJ6898-02 30 nmol

SLC39A5 siRNA (Human)

Sign In for Pricing
View Details
Mouse Kelch-Like Protein 34 (KLHL34) ELISA Kit
MBS9907458-01 48 Well

Mouse Kelch-Like Protein 34 (KLHL34) ELISA Kit

Sign In for Pricing
View Details
Mouse Kelch-Like Protein 34 (KLHL34) ELISA Kit
MBS9907458-02 96 Well

Mouse Kelch-Like Protein 34 (KLHL34) ELISA Kit

Sign In for Pricing
View Details
Mouse Kelch-Like Protein 34 (KLHL34) ELISA Kit
MBS9907458-03 5x 96 Well

Mouse Kelch-Like Protein 34 (KLHL34) ELISA Kit

Sign In for Pricing
View Details