Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ALDH16A1 Rabbit Monoclonal Antibody
1749-01 20 μL

Anti-ALDH16A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-ALDH16A1 Rabbit Monoclonal Antibody
1749-02 100 μL

Anti-ALDH16A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TGF-beta 3 Antibody (TGFB3/4801) [Alexa Fluor 647]
NBP3-27017AF647 0.1 mL

Mouse Monoclonal TGF-beta 3 Antibody (TGFB3/4801) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human KCNQ5 qPCR Primer Pair
QH46701S 200 Tests

Human KCNQ5 qPCR Primer Pair

Sign In for Pricing
View Details
Human Phospho-FAK (S843) MAb (Clone 743101)
MAB7298-SP 25 µg

Human Phospho-FAK (S843) MAb (Clone 743101)

Sign In for Pricing
View Details
DFNA54 Protein Vector (Human) (pPB-C-His)
PV072957 500 ng

DFNA54 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details