Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB6 (HSJ2, MRJ, MSJ1, DnaJ Homolog Subfamily B Member 6, HHDJ1, Heat Shock Protein J2, HSJ-2, MSJ-1, MGC1152, MGC117297, DKFZp566D0824, FLJ42837) (Biotin)
125939-Biotin 100 µL

DNAJB6 (HSJ2, MRJ, MSJ1, DnaJ Homolog Subfamily B Member 6, HHDJ1, Heat Shock Protein J2, HSJ-2, MSJ-1, MGC1152, MGC117297, DKFZp566D0824, FLJ42837) (Biotin)

Sign In for Pricing
View Details
Rat Vomeronasal type-1 receptor 97 (VOM1R97) ELISA Kit
abx552806 96 Tests

Rat Vomeronasal type-1 receptor 97 (VOM1R97) ELISA Kit

Sign In for Pricing
View Details
Fish Keratin, Type I Cuticular Ha3-II (KRT33B) ELISA Kit
MBS9946125 Inquire

Fish Keratin, Type I Cuticular Ha3-II (KRT33B) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Cyclin Tl  Antibody, Affinity Purified
A303-498A 20 µg

Rabbit anti-Cyclin Tl Antibody, Affinity Purified

Sign In for Pricing
View Details
Human Mucopolysacharide MLC ELISA Kit
BG-HUM11460 1 Each

Human Mucopolysacharide MLC ELISA Kit

Sign In for Pricing
View Details
APC-Cy7 Linked Polyclonal Antibody to Cross Linked C-Telopeptide Of Type III Collagen (CTXIII)
MBS2117120-01 0.1 mL

APC-Cy7 Linked Polyclonal Antibody to Cross Linked C-Telopeptide Of Type III Collagen (CTXIII)

Sign In for Pricing
View Details