Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSR3 AAV Vector (Mouse) (CMV)
45548104 1 µg

SSR3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Human IL-23 (Interleukin 23) ELISA Kit
EKF57645 96 Tests

Human IL-23 (Interleukin 23) ELISA Kit

Sign In for Pricing
View Details
MNDA Antibody - middle region
MBS3221815-01 0.1 mL

MNDA Antibody - middle region

Sign In for Pricing
View Details
MNDA Antibody - middle region
MBS3221815-02 5x 0.1 mL

MNDA Antibody - middle region

Sign In for Pricing
View Details
Rabbit anti-CNPase Antibody
MBS4509203-01 0.05 mL

Rabbit anti-CNPase Antibody

Sign In for Pricing
View Details
Rabbit anti-CNPase Antibody
MBS4509203-02 0.1 mL

Rabbit anti-CNPase Antibody

Sign In for Pricing
View Details