Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Biotinylcaproylaminocaproylaminoethyl Methanethiosulfonate (MTSEA-BIOTINCAPCAP)
B1763-02 10 mg

N-Biotinylcaproylaminocaproylaminoethyl Methanethiosulfonate (MTSEA-BIOTINCAPCAP)

Sign In for Pricing
View Details
MDM1 antibody
70R-6273 50 ug

MDM1 antibody

Sign In for Pricing
View Details
Dld (NM_199385) Rat Tagged ORF Clone Lentiviral Particle
RR201558L4V 200 µL

Dld (NM_199385) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LY 3200882 10mg
A16816-10 10 mg

LY 3200882 10mg

Sign In for Pricing
View Details
MAN1A2 (Mannosyl-Oligosaccharide 1,2-Alpha-Mannosidase IB, Mannosidase, Alpha, Class 1A, Member 2)
485322 100 µL

MAN1A2 (Mannosyl-Oligosaccharide 1,2-Alpha-Mannosidase IB, Mannosidase, Alpha, Class 1A, Member 2)

Sign In for Pricing
View Details
CRBN ligand-614
HY-W1008601 1 Each

CRBN ligand-614

Sign In for Pricing
View Details