Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Turkey Total Immunoglobin ELISA Kit
GR187151 96 Well

Nori® Turkey Total Immunoglobin ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SPDYE3 shRNA (UAS) - Lentiviral human SPDYE3 shRNA (UAS) plasmid
GTR15304126 1 Vial

Lentiviral human SPDYE3 shRNA (UAS) - Lentiviral human SPDYE3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
SSNA1 (Sjoegren Syndrome Nuclear Autoantigen 1, Nuclear Autoantigen of 14kD, N14, NA14, NA-14)
133866 50 µg

SSNA1 (Sjoegren Syndrome Nuclear Autoantigen 1, Nuclear Autoantigen of 14kD, N14, NA14, NA-14)

Sign In for Pricing
View Details
Goosecoid Overexpression Lysate (Native) - (Dry Ice)
NBL1-11357 0.1 mg

Goosecoid Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
SIX1 cDNA Clone
MBS1266468-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

SIX1 cDNA Clone

Sign In for Pricing
View Details
SIX1 cDNA Clone
MBS1266468-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

SIX1 cDNA Clone

Sign In for Pricing
View Details