Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HAAO Antibody [mFluor Violet 500 SE]
NBP1-77361MFV500 0.1 mL

Rabbit Polyclonal HAAO Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Calpain 9 (CAPN9) Human qPCR Template Standard (NM_006615)
HK209885 1 Kit

Calpain 9 (CAPN9) Human qPCR Template Standard (NM_006615)

Sign In for Pricing
View Details
TRNAE9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48017111 3x 1.0 µg

TRNAE9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CDKL1 (Cyclin-dependent Kinase-like 1 (CDC2-related Kinase), P42, KKIALRE) (PE)
207538-PE 100 µL

CDKL1 (Cyclin-dependent Kinase-like 1 (CDC2-related Kinase), P42, KKIALRE) (PE)

Sign In for Pricing
View Details
Recombinant Chicken Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B)
MBS1354742-01 0.02 mg (E-Coli)

Recombinant Chicken Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B)

Sign In for Pricing
View Details
Recombinant Chicken Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B)
MBS1354742-02 0.02 mg (Yeast)

Recombinant Chicken Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B)

Sign In for Pricing
View Details