Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YHO-13177
C12146 5 mg

YHO-13177

Sign In for Pricing
View Details
2-Hydroxy-17β-estradiol
013724 2.5 mg

2-Hydroxy-17β-estradiol

Sign In for Pricing
View Details
Rabbit Polyclonal MFF Antibody [Janelia Fluor 669]
NBP3-18439JF669 0.1 mL

Rabbit Polyclonal MFF Antibody [Janelia Fluor 669]

Sign In for Pricing
View Details
ARSA, CT (ARSA, Arylsulfatase A, Cerebroside-sulfatase, Arylsulfatase A component B, Arylsulfatase A component C) (Azide free) (HRP)
MBS6121455-01 0.2 mL

ARSA, CT (ARSA, Arylsulfatase A, Cerebroside-sulfatase, Arylsulfatase A component B, Arylsulfatase A component C) (Azide free) (HRP)

Sign In for Pricing
View Details
ARSA, CT (ARSA, Arylsulfatase A, Cerebroside-sulfatase, Arylsulfatase A component B, Arylsulfatase A component C) (Azide free) (HRP)
MBS6121455-02 5x 0.2 mL

ARSA, CT (ARSA, Arylsulfatase A, Cerebroside-sulfatase, Arylsulfatase A component B, Arylsulfatase A component C) (Azide free) (HRP)

Sign In for Pricing
View Details
Recombinant Shigella sonnei (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)
MBS1424451-01 0.02 mg (E-Coli)

Recombinant Shigella sonnei (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)

Sign In for Pricing
View Details