Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Nuclear Factor Kappa B p65 (NF-κB p65) ELISA Kit
NSL1175Po 96 Tests

Porcine Nuclear Factor Kappa B p65 (NF-κB p65) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Ribosome maturation protein SBDS Antibody [Janelia Fluor 646]
NBP2-98463JF646 0.1 mL

Rabbit Polyclonal Ribosome maturation protein SBDS Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
ZPBP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51949061 1.0 µg DNA

ZPBP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pik3r4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4844706 1.0 µg DNA

Pik3r4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Anti Mouse beta Tubulin Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)
MBS8424918-01 0.12 mL

Rabbit Anti Mouse beta Tubulin Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Mouse beta Tubulin Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)
MBS8424918-02 5x 0.12 mL

Rabbit Anti Mouse beta Tubulin Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH 7.4)(Western Blot, IHC-p, Immunofluorescence, ELISA)

Sign In for Pricing
View Details