Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFXN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43615061 1.0 µg DNA

SFXN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AdmiRa-rno-miR-363-3p-Off Virus
mr5451 1.0 mL

AdmiRa-rno-miR-363-3p-Off Virus

Sign In for Pricing
View Details
MAP1A Knockout AGS Polyclonal Cells
ARG2346 1 Million

MAP1A Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
DHX38 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 38, DDX38, KIAA0224, PRP16, PRPF16) (PE)
MBS6187769-01 0.1 mL

DHX38 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 38, DDX38, KIAA0224, PRP16, PRPF16) (PE)

Sign In for Pricing
View Details
DHX38 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 38, DDX38, KIAA0224, PRP16, PRPF16) (PE)
MBS6187769-02 5x 0.1 mL

DHX38 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 38, DDX38, KIAA0224, PRP16, PRPF16) (PE)

Sign In for Pricing
View Details
Mouse Cstpp1 qPCR Primer Pair
QM58506S 200 Tests

Mouse Cstpp1 qPCR Primer Pair

Sign In for Pricing
View Details