Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-human-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Formula

972 (Gene_ID) NP_004346.1 (Q73-M232) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 Mouse Monoclonal Antibody [Clone ID: OTI2A10]
TA813265S 30 µL

CD47 Mouse Monoclonal Antibody [Clone ID: OTI2A10]

Sign In for Pricing
View Details
UBXN10 Protein Lysate (Rat) with C-HA Tag
49062036 100 µg

UBXN10 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Olfr1447 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4231408 1.0 µg DNA

Olfr1447 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HDAC10 Protein Vector (Human) (pPB-N-His)
PV052974 500 ng

HDAC10 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
RPL7P22 AAV siRNA Pooled Vector
41881161 1.0 µg

RPL7P22 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NOX1 Rabbit Polyclonal Antibody
TA379237 100 µL

NOX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details