LY6G6D, Human (P.pastoris, His)
LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html
Purity
98.0
Smiles
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Molecular Formula
58530 (Gene_ID) O95868 (N20-S104) (Accession)
Molecular Weight
11 & 22 kDa in SDS-PAGE may be due to homodimer
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PHACTR3 (Phosphatase And Actin Regulator 3, C20orf101, H17739, MGC117178, SCAPIN1, SCAPININ) (MaxLight 550)
PHACTR3 (Phosphatase And Actin Regulator 3, C20orf101, H17739, MGC117178, SCAPIN1, SCAPININ) (MaxLight 550)
