Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1310571 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6061308 1.0 µg DNA

RGD1310571 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rat Probable DNA dC->dU-editing enzyme APOBEC3 (APOBEC3) ELISA Kit
abx500486 96 Tests

Rat Probable DNA dC->dU-editing enzyme APOBEC3 (APOBEC3) ELISA Kit

Sign In for Pricing
View Details
Cleaved-Caspase 1 (Ala317), p10 Antibody
AF4022-01 50 µL

Cleaved-Caspase 1 (Ala317), p10 Antibody

Sign In for Pricing
View Details
Cleaved-Caspase 1 (Ala317), p10 Antibody
AF4022-02 100 µL

Cleaved-Caspase 1 (Ala317), p10 Antibody

Sign In for Pricing
View Details
Cleaved-Caspase 1 (Ala317), p10 Antibody
AF4022-03 200 µL

Cleaved-Caspase 1 (Ala317), p10 Antibody

Sign In for Pricing
View Details
UBE2A Rabbit pAb (APR19156N)
APR19156N-01 50 µL

UBE2A Rabbit pAb (APR19156N)

Sign In for Pricing
View Details