Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFAIP6 Polyclonal Antibody
E55A02491 100 µg

TNFAIP6 Polyclonal Antibody

Sign In for Pricing
View Details
Gm12657 Protein Vector (Mouse) (pPM-C-HA)
PV182820 500 ng

Gm12657 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FBXL7 CytoSection
TS410441P5 25 Slides

FBXL7 CytoSection

Sign In for Pricing
View Details
Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4, AR, DHTR, NR3C4) (MaxLight 405) discontinued
123314-ML405 100 µL

Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4, AR, DHTR, NR3C4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Streptokinase (AP) discontinued
S7974-98B-AP 100 µL

Streptokinase (AP) discontinued

Sign In for Pricing
View Details
Chicken Oncostatin M Receptor ELISA Kit
MBS743504-01 48 Well

Chicken Oncostatin M Receptor ELISA Kit

Sign In for Pricing
View Details