Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S) -1-Boc-3-aminopyrrolidine
HY-40098-01 5 g

(S) -1-Boc-3-aminopyrrolidine

Sign In for Pricing
View Details
(S) -1-Boc-3-aminopyrrolidine
HY-40098-02 10 g

(S) -1-Boc-3-aminopyrrolidine

Sign In for Pricing
View Details
SGSH, CT (SGSH, HSS, N-sulphoglucosamine sulphohydrolase, Sulfoglucosamine sulfamidase, Sulphamidase) (FITC)
041675-FITC 200 µL

SGSH, CT (SGSH, HSS, N-sulphoglucosamine sulphohydrolase, Sulfoglucosamine sulfamidase, Sulphamidase) (FITC)

Sign In for Pricing
View Details
Cabp2 (NM_013878) Mouse Tagged ORF Clone Lentiviral Particle
MR219040L4V 200 µL

Cabp2 (NM_013878) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal DDOST Antibody (OTI2B4) [Alexa Fluor 750]
NBP2-70561AF750 0.1 mL

Mouse Monoclonal DDOST Antibody (OTI2B4) [Alexa Fluor 750]

Sign In for Pricing
View Details
REM1 antibody
MBS5302539-01 0.1 mL

REM1 antibody

Sign In for Pricing
View Details