Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp580 sgRNA CRISPR Lentivector set (Mouse)
K4096701 3x 1.0 µg

Zfp580 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
GENLISA™ Rat Eosinophil Chemotactic Factor (Ccl11) ELISA
KLR0558 96 Well

GENLISA™ Rat Eosinophil Chemotactic Factor (Ccl11) ELISA

Sign In for Pricing
View Details
2/88 SOW Surrogate Spike Dibutylchlorendate - 1ML
DBC-X 1 mL

2/88 SOW Surrogate Spike Dibutylchlorendate - 1ML

Sign In for Pricing
View Details
2-Pyridin-4-yl-2,3-dihydro-1H-quinazolin-4-one
sc-308651 500 mg

2-Pyridin-4-yl-2,3-dihydro-1H-quinazolin-4-one

Sign In for Pricing
View Details
Rabbit Polyclonal GRASP55 Antibody [mFluor Violet 450 SE]
NBP2-99119MFV450 0.1 mL

Rabbit Polyclonal GRASP55 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Mouse Human CD95
MBS8559225-01 0.1 mL

Mouse Human CD95

Sign In for Pricing
View Details