Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Histone H2B type 1-B Protein, His-SUMO, E.coli-500ug
QP6159-ec-500ug 500ug

Recombinant Human Histone H2B type 1-B Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
GENLISA Canine Desmoglein 3 (DSG3) ELISA
KLN0546 1x 96 Well

GENLISA Canine Desmoglein 3 (DSG3) ELISA

Sign In for Pricing
View Details
Adherens junction-associated protein 1 (AJAP1) Human ELISA Kit
B2951 96 Tests

Adherens junction-associated protein 1 (AJAP1) Human ELISA Kit

Sign In for Pricing
View Details
UBAP2L Protein Vector (Mouse) (pPM-C-His)
PV243457 500 ng

UBAP2L Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DYKDDDDK Tag Antibody (HRP)
abx414922 100 µg

DYKDDDDK Tag Antibody (HRP)

Sign In for Pricing
View Details
Protein Pellino Homolog 1 (PELI1) BioAssayTM ELISA Kit (Human) discontinued
202623-01 48 Tests

Protein Pellino Homolog 1 (PELI1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details