Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

K Electrode w/fill sollition
A11-120-1 1 unit

K Electrode w/fill sollition

Sign In for Pricing
View Details
IL6 Mouse Monoclonal Antibody [Clone ID: LBI6D1]
AMM21282VCF 100 µg

IL6 Mouse Monoclonal Antibody [Clone ID: LBI6D1]

Sign In for Pricing
View Details
Olr380 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV636516 1.0 µg DNA

Olr380 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
RCVRN Antibody (C-term)
MBS9208866-01 0.08 mL

RCVRN Antibody (C-term)

Sign In for Pricing
View Details
RCVRN Antibody (C-term)
MBS9208866-02 0.4 mL

RCVRN Antibody (C-term)

Sign In for Pricing
View Details
RCVRN Antibody (C-term)
MBS9208866-03 5x 0.4 mL

RCVRN Antibody (C-term)

Sign In for Pricing
View Details