Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-RAPGEF6 (2C5)
LF-MA10276 100 ug

anti-RAPGEF6 (2C5)

Sign In for Pricing
View Details
Rat PLK2 (Polo Like Kinase 2) ELISA Kit
EK247212 96 Well

Rat PLK2 (Polo Like Kinase 2) ELISA Kit

Sign In for Pricing
View Details
Lcn8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3498007 1.0 µg DNA

Lcn8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ganglioside GM1 sodium salt
sc-202624 1 mg

Ganglioside GM1 sodium salt

Sign In for Pricing
View Details
3,5-Diiodo-L-tyrosine 98+%
232311-01 5 g

3,5-Diiodo-L-tyrosine 98+%

Sign In for Pricing
View Details
3,5-Diiodo-L-tyrosine 98+%
232311-02 25 g

3,5-Diiodo-L-tyrosine 98+%

Sign In for Pricing
View Details