Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceramide glucosyltransferase (UGCG) Rabbit Polyclonal Antibody
TA368814 100 µL

Ceramide glucosyltransferase (UGCG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRCA3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0193703 1.0 µg DNA

BRCA3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CTNNBL1 discontinued
312287 100 µL

CTNNBL1 discontinued

Sign In for Pricing
View Details
C1orf127 Antibody, FITC conjugated
A65612-50UG 50 µg

C1orf127 Antibody, FITC conjugated

Sign In for Pricing
View Details
Lentiviral human FPGT shRNA (UAS) - Lentiviral human FPGT shRNA (UAS, iRFP) plasmid
GTR15153616 1 Vial

Lentiviral human FPGT shRNA (UAS) - Lentiviral human FPGT shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
EmL1 (NM_001025741) Rat Tagged Lenti ORF Clone
RR207276L3 10 µg

EmL1 (NM_001025741) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details