Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Enolase 1 Antibody (253) [DyLight 680]
NBP2-25147FR 0.1 mL

Mouse Monoclonal Enolase 1 Antibody (253) [DyLight 680]

Sign In for Pricing
View Details
Uhrf1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3002902 1.0 µg DNA

Uhrf1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
anti-FLJ31438
YF-PA22178 50 ug

anti-FLJ31438

Sign In for Pricing
View Details
KIR5.1 (KCNJ16) (NM_170742) Human Over-expression Lysate
LH15006V 100 µg

KIR5.1 (KCNJ16) (NM_170742) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human HNF4G shRNA (UAS) - Lentiviral human HNF4G shRNA (UAS) (100)
GTR15135726 1 Vial

Lentiviral human HNF4G shRNA (UAS) - Lentiviral human HNF4G shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Golgi apparatus membrane protein tvp38 (tvp38)
MBS7032436-01 0.02 mg

Recombinant Schizosaccharomyces pombe Golgi apparatus membrane protein tvp38 (tvp38)

Sign In for Pricing
View Details