Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G6D, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html

Purity

98.0

Smiles

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Formula

58530 (Gene_ID) O95868 (N20-S104) (Accession)

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Protocadherin 18 (PCDH18) ELISA Kit
MBS9350404 Inquire

Goat Protocadherin 18 (PCDH18) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Zfp955b shRNA (UAS) - Lentiviral mouse Zfp955b shRNA (UAS, GFP) plasmid
GTR15286114 1 Vial

Lentiviral mouse Zfp955b shRNA (UAS) - Lentiviral mouse Zfp955b shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal CENPO Antibody [DyLight 488]
NBP1-76240G 0.1 mL

Rabbit Polyclonal CENPO Antibody [DyLight 488]

Sign In for Pricing
View Details
Ptpn22 Rat shRNA Plasmid (Locus ID 295338)
TL705040 1 Kit

Ptpn22 Rat shRNA Plasmid (Locus ID 295338)

Sign In for Pricing
View Details
Quick-16S Plus NGS Library Prep Kit (V1-V2)
D6434-PS1 96 Reactions

Quick-16S Plus NGS Library Prep Kit (V1-V2)

Sign In for Pricing
View Details
MRPL38 Human qPCR Template Standard (NM_032478)
HK211356 1 Kit

MRPL38 Human qPCR Template Standard (NM_032478)

Sign In for Pricing
View Details