LY6G6D, Human (P.pastoris, His)
LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
LY6G6D Protein, Human (P.pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ly6g6d-protein-human-p-pastoris-his.html
Purity
98.0
Smiles
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Molecular Formula
58530 (Gene_ID) O95868 (N20-S104) (Accession)
Molecular Weight
11 & 22 kDa in SDS-PAGE may be due to homodimer
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse Nt5c2 shRNA (UAS) - Lentiviral mouse Nt5c2 shRNA (UAS) plasmid
E3 SUMO protein ligase PIAS4 (PIAS4) (NM_015897) Human Recombinant Protein
![Recombinant human Carbamoyl-phosphate synthase [ammonia], mitochondrial](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Recombinant human Carbamoyl-phosphate synthase [ammonia], mitochondrial
MYL6P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
KLF16 (Kruppel-like Factor 16, Basic Transcription Element Binding Protein 4, BTE-binding Protein 4, BTEB4, DRRF, Novel Sp1-like Zinc Finger Transcription Factor 2, NSLP2, Transcription Factor BTEB4, Transcription Factor NSLP2) (MaxLight 405) discontinued