Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB Protein, Cynomolgus (HEK293, mFc)

PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived PDGF-BB, expressed by HEK293, with N-mFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Cynomolgus (HEK293, mFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-cynomolgus-hek293-mfc.html

Purity

98.00

Smiles

SLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSP

Molecular Formula

/ (Gene_ID) EHH65851.1 (S82-P190) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF740 conjugate, 0.1mg/mL
BNC741784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (5.8A + MYD712), CF568 conjugate, 0.1mg/mL
BNC680713-100 1x 100 µL

MyoD1 (5.8A + MYD712), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF740 conjugate, 0.1mg/mL
BNC742224-100 1x 100 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL
BNC881868-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF488A conjugate, 0.1mg/mL
BNC881779-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details