Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB Protein, Cynomolgus (HEK293, mFc)

PDGF-BB is a growth factor frequently overexpressed in cancers, are novel potent lymphangiogenic factors. PDGF-BB Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived PDGF-BB, expressed by HEK293, with N-mFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Cynomolgus (HEK293, mFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-cynomolgus-hek293-mfc.html

Purity

98.00

Smiles

SLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSP

Molecular Formula

/ (Gene_ID) EHH65851.1 (S82-P190) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isopropyl 2,3,4,6-tetra-O-benzyl-β-D-glucopyranoside
sc-257630 1 g

Isopropyl 2,3,4,6-tetra-O-benzyl-β-D-glucopyranoside

Sign In for Pricing
View Details
NNC 11-1607
orb1699826-01 50 mg

NNC 11-1607

Sign In for Pricing
View Details
NNC 11-1607
orb1699826-02 100 mg

NNC 11-1607

Sign In for Pricing
View Details
NNC 11-1607
orb1699826-03 25 mg

NNC 11-1607

Sign In for Pricing
View Details
Tubb5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
48817124 3x 1.0µg DNA

Tubb5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rho-Related GTP-Binding Protein RhoC (RHOC) Antibody
abx141581-01 50 µL

Rho-Related GTP-Binding Protein RhoC (RHOC) Antibody

Sign In for Pricing
View Details