Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Glutamate/aspartate import permease protein GltK (gltK), partial

Product Specifications

Abbreviation

Recombinant E.coli gltK protein, partial

Gene Name

GltK

UniProt

P0AER5

Expression Region

113-154aa

Organism

Escherichia coli (strain K12)

Target Sequence

SEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAM

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Part of the ABC transporter complex GltIJKL involved in glutamate and aspartate uptake. Probably responsible for the translocation of the substrate across the membrane. ; (Microbial infection) Probably transports the toxic C-terminal region of CdiA from P.luminescens strain TTO1 across the inner membrane to the cytoplasm, where CdiA has a toxic effect. Toxin transport is strain-specific, mutations in this gene do not confer resistance to several other tested CdiA toxins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Parapertussis folE2 Protein (aa 1-265)
VAng-Lsx4377-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Parapertussis folE2 Protein (aa 1-265)

Sign In for Pricing
View Details
Mouse Prr30 activation kit by CRISPRa
GA210558 1 Kit

Mouse Prr30 activation kit by CRISPRa

Sign In for Pricing
View Details
Tulp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K5024005 3x 1.0 µg

Tulp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Elongation Factor Tu GTP-Binding Domain-Containing Protein 2 (EFTUD2) ELISA Kit
abx387066 96 Tests

Human Elongation Factor Tu GTP-Binding Domain-Containing Protein 2 (EFTUD2) ELISA Kit

Sign In for Pricing
View Details
Glucagon Receptor (GCGR) Antibody
abx432752 200 µL

Glucagon Receptor (GCGR) Antibody

Sign In for Pricing
View Details
Mapk1 (NM_053842) Rat Tagged Lenti ORF Clone
RR209609L4 10 µg

Mapk1 (NM_053842) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details