Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial, Biotinylated

Product Specifications

Product Name Alternative

(B-cell maturation protein) (CD antigen CD269)

Abbreviation

Recombinant Human TNFRSF17 protein, partial, Biotinylated

Gene Name

TNFRSF17

UniProt

Q02223

Expression Region

1-54aa

Organism

Homo sapiens (Human)

Target Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Tag

C-terminal mFc-Avi-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.9 kDa

References & Citations

"A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t (4;16) (q26; p13) translocation in a malignant T cell lymphoma." Laabi Y., Gras M.P., Carbonnel F., Brouet J.C., Berger R., Larsen C.-J., Tsapis A. EMBO J. 11:3897-3904 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eugon LT 1 Agar
LA9850 250 g

Eugon LT 1 Agar

Sign In for Pricing
View Details
Lentiviral mouse Cd38 shRNA (UAS) - Lentiviral mouse Cd38 shRNA (UAS, GFP) (100)
GTR15224805 1 Vial

Lentiviral mouse Cd38 shRNA (UAS) - Lentiviral mouse Cd38 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal ARPC3 Antibody [DyLight 650]
NBP2-99559C 0.1 mL

Rabbit Polyclonal ARPC3 Antibody [DyLight 650]

Sign In for Pricing
View Details
Human Annexin A5 (ANXA5) ELISA Kit
QY-E02147 96 Tests

Human Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
Rat PLA2G2C shRNA Plasmid
abx985465-01 150 µg

Rat PLA2G2C shRNA Plasmid

Sign In for Pricing
View Details
Rat PLA2G2C shRNA Plasmid
abx985465-02 300 µg

Rat PLA2G2C shRNA Plasmid

Sign In for Pricing
View Details