Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Mouse (HEK293, His)

Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2.The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation.Prolactin R Protein, Mouse (HEK293, His) is the recombinant mouse-derived Prolactin R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prlr-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Molecular Formula

19116 (Gene_ID) Q08501 (Q20-D229) (Accession)

Molecular Weight

33-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1199 (Protein KIAA1199, TMEM2L, CCSP1, IR2155535) (FITC)
128796-FITC 100 µL

KIAA1199 (Protein KIAA1199, TMEM2L, CCSP1, IR2155535) (FITC)

Sign In for Pricing
View Details
Glucocorticoid receptor activator 1
MF-0110822-01 10 mg

Glucocorticoid receptor activator 1

Sign In for Pricing
View Details
Glucocorticoid receptor activator 1
MF-0110822-02 50 mg

Glucocorticoid receptor activator 1

Sign In for Pricing
View Details
G CSF Human
OM300803-01 2 µg

G CSF Human

Sign In for Pricing
View Details
G CSF Human
OM300803-02 10 µg

G CSF Human

Sign In for Pricing
View Details
G CSF Human
OM300803-03 1 mg

G CSF Human

Sign In for Pricing
View Details