Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Mouse (HEK293, His)

Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2.The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation.Prolactin R Protein, Mouse (HEK293, His) is the recombinant mouse-derived Prolactin R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prlr-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Molecular Formula

19116 (Gene_ID) Q08501 (Q20-D229) (Accession)

Molecular Weight

33-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXFP2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
42911156 3x 1.0 µg DNA

RXFP2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human Heat Shock Protein 20, HSP-20 ELISA Kit
CK-bio-11795-01 48 Tests

Human Heat Shock Protein 20, HSP-20 ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein 20, HSP-20 ELISA Kit
CK-bio-11795-02 96 Tests

Human Heat Shock Protein 20, HSP-20 ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein 20, HSP-20 ELISA Kit
CK-bio-11795-03 5x 96 Tests

Human Heat Shock Protein 20, HSP-20 ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein 20, HSP-20 ELISA Kit
CK-bio-11795-04 10x 96 Tests

Human Heat Shock Protein 20, HSP-20 ELISA Kit

Sign In for Pricing
View Details
Anti-GNB3 antibody
PAab03541 100 µg

Anti-GNB3 antibody

Sign In for Pricing
View Details