Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Mouse (HEK293, His)

Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2.The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation.Prolactin R Protein, Mouse (HEK293, His) is the recombinant mouse-derived Prolactin R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prlr-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Molecular Formula

19116 (Gene_ID) Q08501 (Q20-D229) (Accession)

Molecular Weight

33-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR56A3 knockdown cell line
ABC-KD10812 1 Vial

Human OR56A3 knockdown cell line

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (APC)
MBS6168939-01 0.1 mL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (APC)

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (APC)
MBS6168939-02 5x 0.1 mL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (APC)

Sign In for Pricing
View Details
Guinea pig Thymus Activation Regulated Chemokine (TARC) ELISA Kit
NSL0197Gp 96 Tests

Guinea pig Thymus Activation Regulated Chemokine (TARC) ELISA Kit

Sign In for Pricing
View Details
Rat Txnrd1 Pre-designed siRNA Set B
SI215459B 1 Each

Rat Txnrd1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human FTO shRNA (UAS) - Lentiviral human FTO shRNA (UAS) (100)
GTR15084750 1 Vial

Lentiviral human FTO shRNA (UAS) - Lentiviral human FTO shRNA (UAS) (100)

Sign In for Pricing
View Details