Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDNF, Human (CHO)

BDNF Protein, Human (CHO) is a neurotrophin binding to the high-affinity tropomyosin-related receptor kinase B (TrkB) receptor to regulate neurodevelopmental processes, including neuronal survival, neuronal differentiation, and synaptic plasticity.

Product Specifications

Product Name Alternative

BDNF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bdnf-protein-human-cho.html

Purity

95.00

Smiles

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Molecular Formula

627 (Gene_ID) P23560-1 (H129-R247) (Accession)

Molecular Weight

Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Li M, et al. Recombinant human brain-derived neurotrophic factor prevents neuronal apoptosis in a novel in vitro model of subarachnoid hemorrhage. Neuropsychiatr Dis Treat. 2017 Apr 3;13:1013-1021.|[2]Hang P, et al. Brain-derived neurotrophic factor attenuates doxorubicin-induced cardiac dysfunction through activating Akt signalling in rats. J Cell Mol Med. 2017 Apr;21 (4) :685-696.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Long-chain fatty acid transport protein 5 (S27A5), partial
orb3011060-01 20 µg

Recombinant Human Long-chain fatty acid transport protein 5 (S27A5), partial

Sign In for Pricing
View Details
Recombinant Human Long-chain fatty acid transport protein 5 (S27A5), partial
orb3011060-02 100 µg

Recombinant Human Long-chain fatty acid transport protein 5 (S27A5), partial

Sign In for Pricing
View Details
Recombinant Human Long-chain fatty acid transport protein 5 (S27A5), partial
orb3011060-03 1 mg

Recombinant Human Long-chain fatty acid transport protein 5 (S27A5), partial

Sign In for Pricing
View Details
OR6T1 Protein Vector (Human) (pPM-C-His)
PV108353 500 ng

OR6T1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rat Camsap3 Pre-designed siRNA Set B
SI201928B 1 Each

Rat Camsap3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Bap1 sgRNA CRISPR Lentivector set (Rat)
K6454301 3x 1.0 µg

Bap1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details