Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM2D1, Human (HEK293, Fc)

The TM2D1 protein may be involved in amyloid beta-induced apoptosis by interacting with beta-APP42, especially amyloid beta protein 42 (APP beta-APP42) . This suggests a role in molecular pathways associated with amyloid-induced cell death. TM2D1 Protein, Human (HEK293, Fc) is the recombinant human-derived TM2D1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

TM2D1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm2d1-protein-human-hek293-fc.html

Purity

92.00

Smiles

TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG

Molecular Formula

83941 (Gene_ID) Q9BX74/NP_114416.1 (T38-G118) (Accession)

Molecular Weight

Approximately 45-60 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CAV1 ELISA Kit
ELA-E0214h 96 Tests

Human CAV1 ELISA Kit

Sign In for Pricing
View Details
Inhibin β B (INHbB) Mouse ELISA Kit
E2620 96 Tests

Inhibin β B (INHbB) Mouse ELISA Kit

Sign In for Pricing
View Details
HDAC11, Recombinant, Human (Histone Deacetylase 11)
MBS636102-01 0.01 mg

HDAC11, Recombinant, Human (Histone Deacetylase 11)

Sign In for Pricing
View Details
HDAC11, Recombinant, Human (Histone Deacetylase 11)
MBS636102-02 5x 0.01 mg

HDAC11, Recombinant, Human (Histone Deacetylase 11)

Sign In for Pricing
View Details
Cyclovirobuxin D (Bebuxine) 25mg
A10262-25 25 mg

Cyclovirobuxin D (Bebuxine) 25mg

Sign In for Pricing
View Details
TSR3 HDR Plasmid (h)
sc-414078-HDR 20 µg

TSR3 HDR Plasmid (h)

Sign In for Pricing
View Details