Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Product Specifications

Product Name Alternative

(168 kDa surface-layer protein) (Cell surface antigen 5) (Sca5) (Surface protein antigen) (rOmp B) (rOmpB) (120 kDa outer membrane protein OmpB) (Surface protein antigen) (p120)

Abbreviation

Recombinant Rickettsia conorii ompB protein, partial

Gene Name

OmpB

UniProt

Q9KKA3

Expression Region

1335-1655aa

Organism

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Target Sequence

GALRYLGTPETAEMAGPEAGAIPAAVAAGDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVVIGLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFSFSLYGAQQLVKNFFAQGSAIFSLNQVKNKSQRYFFDANGNMSKQIAAGHYDNMTFGGNLTVGYDYNAMQGVLVTPMAGLSYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVTGRLSKTQSVLDGQVTPCISQPDRTAKTSYNLGLSASIRSDAKMEYGIGYDAQISSKYTAHQGTLKVRVNF

Tag

C-terminal 6xHis-Avi-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

The 120 kDa surface-exposed protein is a major structural protein which may play a role as a rickettsial virulence factor and/or immunogen during infection. ; The 32 kDa beta peptide may serve as a membrane anchor. It has been shown to adhere to biotinylated Vero cell proteins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (LAMP3/968), 1mg/mL
BNUM0968-50 1x 50 µL

CD63 (LAMP3/968), 1mg/mL

Sign In for Pricing
View Details
Recombinant BST2 Antibody
RC-15621-01 50 μL

Recombinant BST2 Antibody

Sign In for Pricing
View Details
Recombinant BST2 Antibody
RC-15621-02 100 µL

Recombinant BST2 Antibody

Sign In for Pricing
View Details
Recombinant BST2 Antibody
RC-15621-03 1 mL

Recombinant BST2 Antibody

Sign In for Pricing
View Details
PITPNB (C-term) Rabbit Polyclonal Antibody
AP53310PU-N 400 µL

PITPNB (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASCC2 (NM_032204) Human Recombinant Protein
TP303391L 1 mg

ASCC2 (NM_032204) Human Recombinant Protein

Sign In for Pricing
View Details