Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jagged-1/JAG1, Mouse (Myc, His-SUMO)

Jagged-1/JAG1 protein is a multifunctional ligand that binds to multiple Notch receptors and mediates Notch signaling.It influences cell fate decisions during hematopoiesis, spans early and late mammalian cardiovascular development, and regulates myoblast differentiation.Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Jagged-1/JAG1 protein, expressed by E.coli , with C-Myc, N-SUMO, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jagged-1-jag1-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE

Molecular Formula

16449 (Gene_ID) Q9QXX0 (G33-E334) (Accession)

Molecular Weight

Approximately 53.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26 + BA17), CF647 conjugate, 0.1mg/mL
BNC470753-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26 + BA17), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details