Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Jannaschia sp. Uridylate kinase (pyrH)

Product Specifications

CAS Number

9000-83-3

Gene Name

[pyrH]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[pyrH; UK; UMP kinase; UMPK]

Short Name

[Uridylate kinase (pyrH)]

Other Product Names

[UMP kinase; Uridylate kinase; Uridine monophosphate kinase]

NCBI GI Number

499774847

NCBI Accession Number

WP_011455581.1

NCBI GB Accession Number

WP_011455581.1

Uniprot Accession Number

Q28PI5

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFDN2 Antibody
A31024-100UL 100 µL

PFDN2 Antibody

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-02 50 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Urabrelimab Biosimilar, Research Grade
ABS-309-1mg 1 mg

Urabrelimab Biosimilar, Research Grade

Sign In for Pricing
View Details
MAGOHB Antibody
A61765-100UG 100 µg

MAGOHB Antibody

Sign In for Pricing
View Details
RBTN2 discontinued
541661-01 30ul

RBTN2 discontinued

Sign In for Pricing
View Details