Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 8, Human (His)

Carbonic Anhydrase VIII/CA8 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 8 (CA8), an isozyme of α-carbonic anhydrases (CAs), is an allosteric inhibitor of inositol trisphosphate receptor-1 (ITPR1), which regulates neuronal intracellular calcium release[1][2].

Product Specifications

Product Name Alternative

Carbonic Anhydrase 8 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-viii-ca8-protein-human-his.html

Purity

95.0

Smiles

ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQHHHHHH

Molecular Formula

767 (Gene_ID) P35219 (A2-Q290) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gerald Z Zhuang, et al. Human carbonic anhydrase-8 AAV8 gene therapy inhibits nerve growth factor signaling producing prolonged analgesia and anti-hyperalgesia in mice. Gene Ther. 2018 Jul;25 (4) :297-311.|[2]Min-Syuan Huang, et al. Roles of carbonic anhydrase 8 in neuronal cells and zebrafish. Biochim Biophys Acta. 2014 Sep;1840 (9) :2829-42.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UNC93B Overexpression Lysate (Native) - (Dry Ice)
NBP2-06156 0.1 mg

UNC93B Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Trefoil Factor 3 Rabbit mAb
E60M2478 100 µL

Trefoil Factor 3 Rabbit mAb

Ask
View Details
PCBP2 (poly(rC) Binding Protein 2, HNRPE2, MGC110998, hnRNP-E2) (HRP)
MBS6181772-01 0.1 mL

PCBP2 (poly(rC) Binding Protein 2, HNRPE2, MGC110998, hnRNP-E2) (HRP)

Ask
View Details
PCBP2 (poly(rC) Binding Protein 2, HNRPE2, MGC110998, hnRNP-E2) (HRP)
MBS6181772-02 5x 0.1 mL

PCBP2 (poly(rC) Binding Protein 2, HNRPE2, MGC110998, hnRNP-E2) (HRP)

Ask
View Details
RING1 (Ring Finger Protein 1, Ring1A, RNF1) (Biotin)
251128-Biotin 100 µL

RING1 (Ring Finger Protein 1, Ring1A, RNF1) (Biotin)

Ask
View Details
PI3Kδ -IN-1 10mg
A19582-10 10 mg

PI3Kδ -IN-1 10mg

Ask
View Details