Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Mouse

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2].

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-mouse.html

Purity

96.70

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.|[2]Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35 (13) :1467-1480.|[3]Tian XJ, et al. Regeneration of Thyroid Glands in the Spleen Restores Homeostasis in Thyroidectomy Mice. Adv Sci (Weinh) . 2024 Feb;11 (6) :e2305913.|[4]Pan X, et al. Essential Role Of High Glucose-Induced Overexpression Of PKCβ And PKCδ In GLP-1 Resistance In Rodent Cardiomyocytes. Diabetes Metab Syndr Obes. 2019 Nov 4;12:2289-2302.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100P binding protein (S100PBP) Human Gene Knockout Kit (CRISPR)
KN402353 1 Kit

S100P binding protein (S100PBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lung Specific Antigen (LSA120), CF568 conjugate, 0.1mg/mL
BNC680120-500 1x 500 µL

Lung Specific Antigen (LSA120), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Naphthalene-2,6-disulfonate
TRC-S646010-5G 5 g

Sodium Naphthalene-2,6-disulfonate

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), CF594 conjugate, 0.1mg/mL
BNC940053-500 1x 500 µL

HCG-alpha (HCGa/53), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymine DNA glycosylase (TDG) (C-term) Rabbit Polyclonal Antibody
AP17780PU-N 400 µL

Thymine DNA glycosylase (TDG) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704419 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details