Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Mouse

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2].

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-mouse.html

Purity

96.70

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.|[2]Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35 (13) :1467-1480.|[3]Tian XJ, et al. Regeneration of Thyroid Glands in the Spleen Restores Homeostasis in Thyroidectomy Mice. Adv Sci (Weinh) . 2024 Feb;11 (6) :e2305913.|[4]Pan X, et al. Essential Role Of High Glucose-Induced Overexpression Of PKCβ And PKCδ In GLP-1 Resistance In Rodent Cardiomyocytes. Diabetes Metab Syndr Obes. 2019 Nov 4;12:2289-2302.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccar1 (NM_001108535) Rat Tagged Lenti ORF Clone
RR211664L3 10 µg

Ccar1 (NM_001108535) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Chrna4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
16125114 3x 1.0 µg

Chrna4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
pDGIEF Plasmid
PVT11307 2 µg

pDGIEF Plasmid

Sign In for Pricing
View Details
CICP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV759011 1.0 µg DNA

CICP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PKC zeta protein
30R-2833 5 ug

PKC zeta protein

Sign In for Pricing
View Details
Cdk13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4960005 3x 1.0 µg

Cdk13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details