Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blue Fluorescent Protein (BFP)

The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Product Specifications

Shipping Conditions

Gel pack

Storage Conditions

-20°C

Shelf Life

12 months

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Piperazine-1-Carboxylate 99.0%
087725 25 g

Ethyl Piperazine-1-Carboxylate 99.0%

Sign In for Pricing
View Details
Mouse Monoclonal MS4A4A Antibody (3F2) [DyLight 405]
NBP3-12044V 0.1 mL

Mouse Monoclonal MS4A4A Antibody (3F2) [DyLight 405]

Sign In for Pricing
View Details
GFP Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124379-01 0.02 mL

GFP Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
GFP Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124379-02 0.1 mL

GFP Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
GFP Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124379-03 0.5 mL

GFP Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
GFP Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124379-04 5x 0.5 mL

GFP Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details