Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blue Fluorescent Protein (BFP)

The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Product Specifications

Shipping Conditions

Gel pack

Storage Conditions

-20°C

Shelf Life

12 months

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Rabbit Monoclonal Antibody
TD-R23851 100 µL

CD63 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human UBE2N Antibody (Biotin Conjugate)
33069-05121 150 µg

Human UBE2N Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
Vitamin D3 Mouse Monoclonal Antibody [Clone ID: ID125A]
AM02004PU-S 10 µg

Vitamin D3 Mouse Monoclonal Antibody [Clone ID: ID125A]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Epidermal Growth Factor,  15nm
GM-42-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Epidermal Growth Factor, 15nm

Sign In for Pricing
View Details
Recombinant Chromobacterium violaceum Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1413028-01 0.05 mg (E-Coli)

Recombinant Chromobacterium violaceum Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details
Recombinant Chromobacterium violaceum Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1413028-02 0.05 mg (Yeast)

Recombinant Chromobacterium violaceum Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details