Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blue Fluorescent Protein (BFP)

The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Product Specifications

Shipping Conditions

Gel pack

Storage Conditions

-20°C

Shelf Life

12 months

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K4 (MEKK4 (MAP3K4, KIAA0213, MAPKKK4, MEKK4, MTK1, Mitogen-activated Protein Kinase Kinase Kinase 4, MAP Three Kinase 1, MAPK/ERK Kinase Kinase 4, FLJ42439, KIAA0213) (HRP)
129384-HRP 100 µL

MAP3K4 (MEKK4 (MAP3K4, KIAA0213, MAPKKK4, MEKK4, MTK1, Mitogen-activated Protein Kinase Kinase Kinase 4, MAP Three Kinase 1, MAPK/ERK Kinase Kinase 4, FLJ42439, KIAA0213) (HRP)

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-4760-3p Virus
mh6753 1.0 mL

AdmiRa-Off-hsa-miR-4760-3p Virus

Sign In for Pricing
View Details
Mouse Programmed cell death protein 4 (PDCD4) ELISA Kit
RK13592 96 Tests

Mouse Programmed cell death protein 4 (PDCD4) ELISA Kit

Sign In for Pricing
View Details
Testin (TES, TESS, TESS-2) (MaxLight 490)
MBS6440296-01 0.1 mL

Testin (TES, TESS, TESS-2) (MaxLight 490)

Sign In for Pricing
View Details
Testin (TES, TESS, TESS-2) (MaxLight 490)
MBS6440296-02 5x 0.1 mL

Testin (TES, TESS, TESS-2) (MaxLight 490)

Sign In for Pricing
View Details
Olr1384 (NM_001002291) Rat Tagged Lenti ORF Clone
RR214882L3 10 µg

Olr1384 (NM_001002291) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details