Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blue Fluorescent Protein (BFP)

The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Product Specifications

Shipping Conditions

Gel pack

Storage Conditions

-20°C

Shelf Life

12 months

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS2 Protein (N-His, Human)
P500405 100 µg

ALAS2 Protein (N-His, Human)

Sign In for Pricing
View Details
Human ANXA7 siRNA
abx907678-01 15 nmol

Human ANXA7 siRNA

Sign In for Pricing
View Details
Human ANXA7 siRNA
abx907678-02 30 nmol

Human ANXA7 siRNA

Sign In for Pricing
View Details
ERK1 Rabbit mAb
MBS4762076-01 0.1 mL

ERK1 Rabbit mAb

Sign In for Pricing
View Details
ERK1 Rabbit mAb
MBS4762076-02 5x 0.1 mL

ERK1 Rabbit mAb

Sign In for Pricing
View Details
Aldoa (NM_007438) Mouse Tagged Lenti ORF Clone
MR205592L3 10 µg

Aldoa (NM_007438) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details