Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Alpha-synuclein (SNCA)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Pig SNCA protein

Gene Name

SNCA

UniProt

Q3I5G7

Expression Region

1-140aa

Organism

Sus scrofa (Pig)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca2+ release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.5 kDa

References & Citations

"Isolation of the porcine alpha-synuclein gene (SNCA) from cerebellum." Larsen K., Bendixen C. Submitted (MAY-2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal p21/CIP1/CDKN1A Antibody (AC8.3)
NB100-2750-0.025mg 0.025 mg

Mouse Monoclonal p21/CIP1/CDKN1A Antibody (AC8.3)

Sign In for Pricing
View Details
Anti-FMDV Capsid protein VP1 Antibody (4C4)
MBS1569212-01 0.1 mg

Anti-FMDV Capsid protein VP1 Antibody (4C4)

Sign In for Pricing
View Details
Anti-FMDV Capsid protein VP1 Antibody (4C4)
MBS1569212-02 1 mg

Anti-FMDV Capsid protein VP1 Antibody (4C4)

Sign In for Pricing
View Details
Anti-FMDV Capsid protein VP1 Antibody (4C4)
MBS1569212-03 5x 1 mg

Anti-FMDV Capsid protein VP1 Antibody (4C4)

Sign In for Pricing
View Details
Guinea Pig Granzyme A ELISA kit
GTR10464805 96 Well

Guinea Pig Granzyme A ELISA kit

Sign In for Pricing
View Details
Human DSCAM Knockout HEK293T cell line
GTR15401813 1 Vial

Human DSCAM Knockout HEK293T cell line

Sign In for Pricing
View Details