Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Follistatin/FST, Mouse (HEK293, His)

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH) [1][2]. Follistatin/FST Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal 10*His-tag.

Product Specifications

Product Name Alternative

Follistatin/FST Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/follistatin-fst-protein-mouse-hek293-his.html

Purity

96.30

Smiles

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSILEW

Molecular Formula

14313 (Gene_ID) P47931-1 (G30-W344) (Accession)

Molecular Weight

Approximately 43-54 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Jakob Schiøler Hansen, et al. Circulating follistatin in relation to energy metabolism. Mol Cell Endocrinol. 2016 Sep 15;433:87-93.|[2]Ryan G Walker, et al. Heparin-mediated dimerization of follistatin. Exp Biol Med (Maywood) . 2021 Feb;246 (4) :467-482.|[3]D J Phillips, et al. Follistatin: a multifunctional regulatory protein. Front Neuroendocrinol. 1998 Oct;19 (4) :287-322.|[4]A Ikeda, et al. Follistatin expressed in mechanically-damaged salivary glands of male mice induces proliferation of CD49f+ cells. Sci Rep. 2020 Nov 17;10 (1) :19959.|[5]C L Hardy, et al. Follistatin is a candidate endogenous negative regulator of activin A in experimental allergic asthma. Clin Exp Allergy. 2006 Jul;36 (7) :941-50.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF740 conjugate, 0.1mg/mL
BNC740673-100 1x 100 µL

Cyclin A2 (E67), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details