Alkaline Phosphatase/ALPI, Human (HEK293, N-His)
ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, N-His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with N-10*His labeled tag.
Product Specifications
Product Name Alternative
Alkaline Phosphatase/ALPI Protein, Human (HEK293, N-His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/alpi-protein-human-hek293-n-his.html
Purity
97.00
Smiles
VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD
Molecular Formula
248 (Gene_ID) P09923 (V20-D503) (Accession)
Molecular Weight
Approximately 74 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6292647-01 0.1 mL
DNAJB11, NT (DNAJB11, EDJ, ERJ3, HDJ9, DnaJ homolog subfamily B member 11, APOBEC1-binding protein 2, DnaJ protein homolog 9, ER-associated DNAJ, ER-associated Hsp40 co-chaperone, ER-associated dnaJ protein 3, HEDJ, Human DnaJ protein 9, PWP1-interacting
Sign In for Pricing
View Details MBS6292647-02 5x 0.1 mL
DNAJB11, NT (DNAJB11, EDJ, ERJ3, HDJ9, DnaJ homolog subfamily B member 11, APOBEC1-binding protein 2, DnaJ protein homolog 9, ER-associated DNAJ, ER-associated Hsp40 co-chaperone, ER-associated dnaJ protein 3, HEDJ, Human DnaJ protein 9, PWP1-interacting
Sign In for Pricing
View Details 
038312-ML650 100 µL
MeCP2, NT (MECP2, Methyl-CpG-binding protein 2) (MaxLight 650) discontinued
Sign In for Pricing
View Details