Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP14, Human (HEK293, His)

The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FKBP14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fkbp14-protein-human-hek293-his.html

Purity

95.00

Smiles

ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYK

Molecular Formula

55033 (Gene_ID) Q9NWM8 (A20-K207) (Accession)

Molecular Weight

Approximately 25&27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF488A conjugate, 0.1mg/mL
BNC881467-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF647 conjugate, 0.1mg/mL
BNC472748-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF405S conjugate, 0.1mg/mL
BNC040639-100 1x 100 µL

CD31 / PECAM-1 (JC/70A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1030), CF568 conjugate, 0.1mg/mL
BNC681030-500 1x 500 µL

CD66 (CEA) (C66/1030), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details