Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SAP30-binding protein (SAP30BP), partial

Product Specifications

Product Name Alternative

Transcriptional regulator protein HCNGP

Abbreviation

Recombinant Human SAP30BP protein, partial

Gene Name

SAP30BP

UniProt

Q9UHR5

Expression Region

91-308aa

Organism

Homo sapiens (Human)

Target Sequence

TEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Plays a role in transcriptional repression by promoting histone deacetylase activity, leading to deacetylation of histone H3. May be involved in the regulation of beta-2-microglobulin genes. ; (Microbial infection) Involved in transcriptional repression of HHV-1 genes TK and gC.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bapineuzumab Biosimilar - Research Grade
ICH5140-1mg 1 mg

Bapineuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), CF647 conjugate, 0.1mg/mL
BNC472498-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SARS-CoV-2 S protein RBD (K417T), His Tag (MALS verified)
SPD-C52Ht-100ug 100 µg

SARS-CoV-2 S protein RBD (K417T), His Tag (MALS verified)

Sign In for Pricing
View Details
Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-01 20 µg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-02 100 µg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-03 500 µg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details