Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF RI/TNFRSF1A, Human (His)

TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Human (His) is expressed by E. coli with a 6*His tag at the N-terminus[1].

Product Specifications

Product Name Alternative

TNF RI/TNFRSF1A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf1a-protein-human-his.html

Purity

95.0

Smiles

IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Molecular Formula

7132 (Gene_ID) P19438-1 (I22-T211) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[2]Fu Q, et, al. miR-29a up-regulation in AR42J cells contributes to apoptosis via targeting TNFRSF1A gene. World J Gastroenterol. 2016 May 28;22 (20) :4881-90.|[3]Zhou S, et, al. Bioinformatics Analysis Identifies TNFRSF1A as a Biomarker of Liver Injury in Sepsis TNFRSF1A is a Biomarker for Septic Liver Injury. Genet Res (Camb) . 2022 Oct 15;2022:1493744.|[4]Egusquiaguirre SP, et, al. The STAT3 Target Gene TNFRSF1A Modulates the NF-κB Pathway in Breast Cancer Cells. Neoplasia. 2018 May;20 (5) :489-498.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBD1 (Methyl-CpG-binding Domain 1, PCM1, Methyl-CpG-binding Protein MBD1, Protein Containing Methyl-CpG-binding Domain 1, CXXC-type Zinc Finger Protein 3, CXXC3, PCM1) (APC)
129463-APC 100 µL

MBD1 (Methyl-CpG-binding Domain 1, PCM1, Methyl-CpG-binding Protein MBD1, Protein Containing Methyl-CpG-binding Domain 1, CXXC-type Zinc Finger Protein 3, CXXC3, PCM1) (APC)

Sign In for Pricing
View Details
Mouse Monoclonal MKK4/MEK4 Antibody (OTI8A8) - Azide and BSA Free
NBP2-72710 100 µg

Mouse Monoclonal MKK4/MEK4 Antibody (OTI8A8) - Azide and BSA Free

Sign In for Pricing
View Details
ST5 Antibody
E309261 200 µL

ST5 Antibody

Sign In for Pricing
View Details
SB743921
B1590-200 200 mg

SB743921

Sign In for Pricing
View Details
Compound STOCK1N-33888
T127294-01 10 mg

Compound STOCK1N-33888

Sign In for Pricing
View Details
Compound STOCK1N-33888
T127294-02 1 g

Compound STOCK1N-33888

Sign In for Pricing
View Details