Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrobaculum aerophilum Argininosuccinate lyase (argH)

Product Specifications

CAS Number

9000-83-3

Gene Name

[argH]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[argH; ASAL]

Short Name

[Argininosuccinate lyase (argH)]

Other Product Names

[Argininosuccinate lyase; Argininosuccinate lyase; Arginosuccinase]

NCBI GI Number

30172915

NCBI Accession Number

Q8ZU95.1

Uniprot Accession Number

Q8ZU95

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pnp ORF Vector (Mouse) (pORF)
ORF054391 1.0 µg DNA

Pnp ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
SEC24D Recombinant Antibody
bsm-62746R-01 20 µL

SEC24D Recombinant Antibody

Sign In for Pricing
View Details
SEC24D Recombinant Antibody
bsm-62746R-02 100 µL

SEC24D Recombinant Antibody

Sign In for Pricing
View Details
Rat Eotaxin 1 ELISA Kit
MBS749015-01 48 Well

Rat Eotaxin 1 ELISA Kit

Sign In for Pricing
View Details
Rat Eotaxin 1 ELISA Kit
MBS749015-02 96 Well

Rat Eotaxin 1 ELISA Kit

Sign In for Pricing
View Details