Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMNDC1/SPF30, Human (His)

SMNDC1/SPF30 Protein is pivotal in spliceosome assembly, forming associations with spliceosomes, U4/U5/U6 tri-snRNP, and U2 snRNP. Its Tudor domain directly interacts with SNRPD3, emphasizing its crucial role in essential interactions within the splicing machinery and contributing to the intricate process of pre-mRNA splicing. SMNDC1/SPF30 Protein, Human (His) is the recombinant human-derived SMNDC1/SPF30 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SMNDC1/SPF30 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smndc1-spf30-protein-human-his.html

Purity

85.20

Smiles

MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

Molecular Formula

10285 (Gene_ID) O75940 (M1-Q238) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1139521-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1139521-02 0.02 mg (Yeast)

Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1139521-03 0.1 mg (E-Coli)

Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1139521-04 0.1 mg (Yeast)

Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1139521-05 0.02 mg (Baculovirus)

Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1139521-06 0.02 mg (Mammalian-Cell)

Recombinant Clostridium botulinum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details