Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Osteocalcin (BGLAP)

Product Specifications

Product Name Alternative

Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)

Abbreviation

Recombinant Chicken BGLAP protein

Gene Name

BGLAP

UniProt

P02822

Expression Region

49-97aa

Organism

Gallus gallus (Chicken)

Target Sequence

HYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.7 kDa

References & Citations

"Gas chromatographic mass spectrometric sequence determination of osteocalcin, a gamma-carboxyglutamic acid-containing protein from chicken bone." Carr S.A., Hauschka P.V., Biemann K. J. Biol. Chem. 256:9944-9950 (1981)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf33 (NM_001099783) Human Recombinant Protein
TP316543L 1 mg

C4orf33 (NM_001099783) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
ELK4945-01 48 Tests

Mouse SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
Mouse SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
ELK4945-02 96 Tests

Mouse SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
Mouse SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
ELK4945-03 5x 96 Tests

Mouse SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
Anti-Human TNFa/TNF-alpha Nanobody
MBS1567961-01 0.1 mg

Anti-Human TNFa/TNF-alpha Nanobody

Sign In for Pricing
View Details
Anti-Human TNFa/TNF-alpha Nanobody
MBS1567961-02 1 mg

Anti-Human TNFa/TNF-alpha Nanobody

Sign In for Pricing
View Details