Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Vitamin B12-binding protein (btuF), partial

Product Specifications

Product Name Alternative

BtuF; yadT; b0158; JW0154Vitamin B12-binding protein

Abbreviation

Recombinant E.coli btuF protein, partial

Gene Name

BtuF

UniProt

P37028

Expression Region

24-266aa

Organism

Escherichia coli (strain K12)

Target Sequence

PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC.

Molecular Weight

53.9 kDa

References & Citations

Crystal structures of the BtuF periplasmic-binding protein for vitamin B12 suggest a functionally important reduction in protein mobility upon ligand binding.Karpowich N.K., Huang H.H., Smith P.C., Hunt J.F.J. Biol. Chem. 278:8429-8434 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (LN-3 + HLA-DRB/1067), CF594 conjugate, 0.1mg/mL
BNC941208-500 1x 500 µL

HLA-DRB (LN-3 + HLA-DRB/1067), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL
BNC682884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL
BNC941981-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details