Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HE4/WFDC2, Mouse (HEK293, His)

HE4/WFDC2 protein is a disulfide-bonded homotrimer serving as a broad range protease inhibitor. HE4/WFDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HE4/WFDC2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HE4/WFDC2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/he4-wfdc2-protein-mouse-hek293-his.html

Purity

90.0

Smiles

TGTDAEKPGECPQLEPITDCVLECTLDKDCADNRKCCQAGCSSVCSKPNGPSEGELSGTDTKLSETGTTTQSAGLDHTTKPPGGQVSTKPPAVTREGLGVREKQGTCPSVDIPKLGLCEDQCQVDSQCSGNMKCCRNGCGKMACTTPKF

Molecular Formula

67701 (Gene_ID) Q9DAU7 (T26-F174) (Accession)

Molecular Weight

Approximately 23-30 kDa. Glycosylation sites are found in mouse HE4/WFDC2 protein.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Grhl1 (NM_001161406) Mouse Tagged ORF Clone Lentiviral Particle
MR209470L3V 200 µL

Grhl1 (NM_001161406) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
MAPK9 (Mitogen-Activated Protein Kinase 9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, p54a, p54aSAPK) (HRP)
248524-HRP 100 µL

MAPK9 (Mitogen-Activated Protein Kinase 9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, p54a, p54aSAPK) (HRP)

Ask
View Details
250ul Beckman robotic tip, rack, sterile
RT250B 96 PCS/Rack - 50 Racks/Case

250ul Beckman robotic tip, rack, sterile

Ask
View Details
Zinc Transporter ZIP4, Control Peptide (Solute Carrier Family 39 Member 4, Zrt- and Irt-like Protein 4, ZIP-4, hZIP4, SLC39A4, ZIP4)
Z0510-05A 100 µg

Zinc Transporter ZIP4, Control Peptide (Solute Carrier Family 39 Member 4, Zrt- and Irt-like Protein 4, ZIP-4, hZIP4, SLC39A4, ZIP4)

Ask
View Details
Recombinant Bacillus halodurans Carbon storage regulator homolog (csrA)
MBS1463121-01 0.02 mg (E-Coli)

Recombinant Bacillus halodurans Carbon storage regulator homolog (csrA)

Ask
View Details
Recombinant Bacillus halodurans Carbon storage regulator homolog (csrA)
MBS1463121-02 0.1 mg (E-Coli)

Recombinant Bacillus halodurans Carbon storage regulator homolog (csrA)

Ask
View Details