Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Rhesus macaque (His)

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Rhesus macaque (His), Rhesus Macaque, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-rhesus-macaque-his.html

Purity

95.0

Smiles

SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRPFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI

Molecular Formula

717301 (Gene_ID) F7DLG4 (S112-I270) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human NR2F6 Protein, His, Mammal-20ug
QP6434-ma-20ug 20ug

Recombinant Human NR2F6 Protein, His, Mammal-20ug

Ask
View Details
Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit
MBS7251348-01 48 Well

Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit

Ask
View Details
Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit
MBS7251348-02 96 Well

Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit

Ask
View Details
Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit
MBS7251348-03 5x 96 Well

Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit

Ask
View Details
Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit
MBS7251348-04 10x 96 Well

Guinea pig CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit

Ask
View Details
MAP2K5 (Dual Specificity Mitogen-activated Protein Kinase Kinase 5, MAP Kinase Kinase 5, MAPKK 5, MAPK/ERK Kinase 5, MEK5, MKK5, PRKMK5) (Biotin)
129375-Biotin 100 µL

MAP2K5 (Dual Specificity Mitogen-activated Protein Kinase Kinase 5, MAP Kinase Kinase 5, MAPKK 5, MAPK/ERK Kinase 5, MEK5, MKK5, PRKMK5) (Biotin)

Ask
View Details