Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Rhesus macaque (His)

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Rhesus macaque (His), Rhesus Macaque, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-rhesus-macaque-his.html

Purity

95.0

Smiles

SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRPFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI

Molecular Formula

717301 (Gene_ID) F7DLG4 (S112-I270) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-100 1x 100 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF740 conjugate, 0.1mg/mL
BNC742424-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF594 conjugate, 0.1mg/mL
BNC940900-500 1x 500 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL
BNC400205-500 1x 500 µL

Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF488A conjugate, 0.1mg/mL
BNC880810-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (C86/1146), CF405S conjugate, 0.1mg/mL
BNC041146-100 1x 100 µL

CD86 (C86/1146), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details