Zika virus NS1 (HEK293, His)
Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication.Zika virus NS1 Protein (HEK293, His) is the recombinant Virus-derived Zika virus NS1 protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
Zika virus NS1 Protein (HEK293, His), Virus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/zika-virus-ns1-protein-hek293-his.html
Purity
95.00
Smiles
VGCSVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSRMENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSHFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGIEESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTAGSTDHMDHFSL
Molecular Formula
/ (Gene_ID) ALU33341 (V796-L1157) (Accession)
Molecular Weight
Approximately 50 kDa
References & Citations
[1]Kaur V, et al. Polyprotein synthesis: a journey from the traditional pre-translational method to modern post-translational approaches for single-molecule force spectroscopy. Chem Commun (Camb) . 2023 Jun 6;59 (46) :6946-6955.|[2]Crépin T, et al. Polyproteins in structural biology. Curr Opin Struct Biol. 2015 Jun;32:139-46.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400281-500 1x 500 µL
Insulin (E2-E3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details