Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM6, Human (His-SUMO)

The CEACAM6 protein is a cell surface glycoprotein that promotes calcium- and fibronectin-independent cell-cell adhesion and mediates homo- and heterosexual interactions with other carcinoembryonic antigen-related cell adhesion molecules. CEACAM6 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM6 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CEACAM6 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam6-protein-human-his-sumo.html

Purity

96.00

Smiles

KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Molecular Formula

4680 (Gene_ID) P40199 (K35-G320) (Accession)

Molecular Weight

Approximately 47.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCR-XL-TOPO-GLI3
PPL00149S 1 Each

PCR-XL-TOPO-GLI3

Sign In for Pricing
View Details
BRAP Mouse Monoclonal Antibody [Clone ID: 1E7-C9-D10-B10]
TA346897 100 µL

BRAP Mouse Monoclonal Antibody [Clone ID: 1E7-C9-D10-B10]

Sign In for Pricing
View Details
Edoxaban impurity 2 p-toluenesulfonic acid
FE183612-01 1 mg

Edoxaban impurity 2 p-toluenesulfonic acid

Sign In for Pricing
View Details
Edoxaban impurity 2 p-toluenesulfonic acid
FE183612-02 2 mg

Edoxaban impurity 2 p-toluenesulfonic acid

Sign In for Pricing
View Details
Edoxaban impurity 2 p-toluenesulfonic acid
FE183612-03 5 mg

Edoxaban impurity 2 p-toluenesulfonic acid

Sign In for Pricing
View Details
Edoxaban impurity 2 p-toluenesulfonic acid
FE183612-04 10 mg

Edoxaban impurity 2 p-toluenesulfonic acid

Sign In for Pricing
View Details