Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKp44/NCR2, Human (HEK293, His)

The NKp44/NCR2 protein is a cytotoxicity-activating receptor on natural killer (NK) cells that may increase their tumor cell lysis efficiency. NKp44/NCR2 interacts with TYROBP/DAP12, an important signal transduction adapter, and is critical for transducing signals that activate NK cells against target cells. NKp44/NCR2 Protein, Human (HEK293, His) is the recombinant human-derived NKp44/NCR2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NKp44/NCR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkp44-ncr2-protein-human-hek-293-his.html

Purity

98.97

Smiles

QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

Molecular Formula

9436 (Gene_ID) O95944/NP_004819.2 (Q22-P190) (Accession)

Molecular Weight

Approximately 30-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details