Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKp44/NCR2, Human (HEK293, His)

The NKp44/NCR2 protein is a cytotoxicity-activating receptor on natural killer (NK) cells that may increase their tumor cell lysis efficiency. NKp44/NCR2 interacts with TYROBP/DAP12, an important signal transduction adapter, and is critical for transducing signals that activate NK cells against target cells. NKp44/NCR2 Protein, Human (HEK293, His) is the recombinant human-derived NKp44/NCR2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NKp44/NCR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkp44-ncr2-protein-human-hek-293-his.html

Purity

98.97

Smiles

QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

Molecular Formula

9436 (Gene_ID) O95944/NP_004819.2 (Q22-P190) (Accession)

Molecular Weight

Approximately 30-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnd2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4479503 1.0 µg DNA

Rnd2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
p16 INK4a (pS326) Blocking Peptide
abx161344-01 1 mg

p16 INK4a (pS326) Blocking Peptide

Sign In for Pricing
View Details
p16 INK4a (pS326) Blocking Peptide
abx161344-02 5 mg

p16 INK4a (pS326) Blocking Peptide

Sign In for Pricing
View Details
RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) APC
MBS6391826-01 0.1 mL

RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) APC

Sign In for Pricing
View Details
RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) APC
MBS6391826-02 5x 0.1 mL

RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) APC

Sign In for Pricing
View Details
POK3 rabbit pAb
ES14035-01 50 µL

POK3 rabbit pAb

Sign In for Pricing
View Details